PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G029600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 1180aa    MW: 126750 Da    PI: 6.2502
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G029600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.19.8e-09449491347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W++eE +++ + ++ +G++ +k+I++ +  ++t+ +c++++ k+
  Seita.7G029600.1.p 449 AWSQEEKDIFSEKITTFGTD-FKKISSFLS-HKTPTDCIEYYSKH 491
                         7*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129313.858445496IPR017884SANT domain
SMARTSM007174.1E-9446494IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-10448494IPR009057Homeodomain-like
CDDcd001674.41E-6449491No hitNo description
Gene3DG3DSA:1.10.10.603.8E-6449493IPR009057Homeodomain-like
PfamPF139212.9E-6450499No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1180 aa     Download sequence    Send to blast
MNRGFPWSPY GWGPSYWNQN QNQQQWAWHV RDPYWNQRTR FSNVGWNAGV PQPGGLMGHP  60
SYNSPRPLGI QRDVAPMHYF CRPPRPPPPQ RGRVSPGGQS SNSSGQHRGR DLDRDAGKGL  120
LGPGDDPSSQ RGETPFLPPK KRAEFKSPEL HSGQHGNGSD DNSSKSATEK PLDPVQETPD  180
PPPASSTKTG LGSLVPPAVS APTPLESPDV DVCMTERNDQ GDVLGLGGYM EKKRLLSKTL  240
FADVEGEVKV TTKKTRLGWG QGLAKYEKQL KQQNGQKLVA DGDNGETGNG AVVYTATAPA  300
SSDRQTPTPD VGGSSNPCNN SLSMTETVTC TATVPISSHG SSPPPAGGGN SDISNSSMST  360
TQGISCPAST HGCSLPSGAH ISYGSNAKST KVQDISHKLI SQPINKIQNS ARMPAIIIRK  420
LQKPREFLNK NILFKEPQTN KLQGSGFKAW SQEEKDIFSE KITTFGTDFK KISSFLSHKT  480
PTDCIEYYSK HYKSVCSKKS NKCVPTTKQS QEKCKNVNDA APYMSGIATV TATKNYKKMK  540
TVEEDLKKPA NQICHESTAH LQSHSLPDKG HHVESTIEEY EHVTGNVLVG EMNAPSLHGM  600
NSPTTNSSEA ARLTIPKTEV AEFVSNVDSA TCIIQSYSKV KENVPQPVTS ADHGDGENYQ  660
AGGSSGQGTS EIIKYLSESG QKIPNVTTED SQTISGEENP ELCAVSKECN DAAEHSWNDD  720
TETNSNTHND NNAPSDMENP TNDNNPCIST NSAELSGHHE LVQPLEDSEA LKIGSKENND  780
KAIRDEKNPE HSIASKEGSG ILLGCIVNSQ RDKEVVDIIS SPEGSDLNVP PTLASLGASN  840
NSHLSSTSSS AALQTVYAKS SRGEVDMDLN LPLHVAPPDL ASVALDSNRA EASMDLHEPR  900
QTIDVAAIME HELSIRARET IDVGGDSEAA NDVTHVQEIH QSSQTTVAET SHHPANQPGC  960
IMLFGQVIYQ APSSSGTNPT SSQGNQIVAS SRDIPSETVV PFRAGSGQLY PSGPSIIWRS  1020
APVNLGQQTV LSNNTMNLDQ QAVLSNNTMN LGQQAVLSNT TMPYGSTSGA AWRPLQLRNS  1080
ALVNMSQQRQ YVHMMMQYSM MRGAVPYHLR QESSSSSGGG LINFNNFNPG QQQWPSNILD  1140
TSRVVMGYPC LPGSTQDQAP TAIMPSGINI EGASTSNTG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2099133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.14e-11MYB family protein